SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gzzg1 (5gzz G:1-80)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2117361Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 protein domains)
  6. 2117372Protein Class alpha GST [81360] (8 species)
  7. 2117498Species Schistosoma japonicum [TaxId:6182] [52878] (14 PDB entries)
    Uniprot P08515
  8. 2286416Domain d5gzzg1: 5gzz G:1-80 [329717]
    Other proteins in same PDB: d5gzzb2, d5gzzc2, d5gzzd2, d5gzze1, d5gzze2, d5gzzf1, d5gzzf2, d5gzzg2
    automated match to d1m9aa2
    complexed with gsh, jaa

Details for d5gzzg1

PDB Entry: 5gzz (more details), 2.39 Å

PDB Description: crystal structure of fin219-sjgst complex with ja
PDB Compounds: (G:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d5gzzg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzzg1 c.47.1.5 (G:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn

SCOPe Domain Coordinates for d5gzzg1:

Click to download the PDB-style file with coordinates for d5gzzg1.
(The format of our PDB-style files is described here.)

Timeline for d5gzzg1:

  • d5gzzg1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-15