Lineage for d5gzzf2 (5gzz F:81-216)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1999700Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1999701Protein automated matches [226831] (61 species)
    not a true protein
  7. 2000105Species Schistosoma japonicum [TaxId:6182] [276183] (3 PDB entries)
  8. 2000109Domain d5gzzf2: 5gzz F:81-216 [329744]
    Other proteins in same PDB: d5gzzb1, d5gzzb2, d5gzzc1, d5gzzc2, d5gzzd1, d5gzzd2, d5gzze1, d5gzzf1, d5gzzg1, d5gzzg2
    automated match to d3isoa2
    complexed with gsh, jaa

Details for d5gzzf2

PDB Entry: 5gzz (more details), 2.39 Å

PDB Description: crystal structure of fin219-sjgst complex with ja
PDB Compounds: (F:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d5gzzf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzzf2 a.45.1.0 (F:81-216) automated matches {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhp

SCOPe Domain Coordinates for d5gzzf2:

Click to download the PDB-style file with coordinates for d5gzzf2.
(The format of our PDB-style files is described here.)

Timeline for d5gzzf2: