Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [188549] (62 PDB entries) |
Domain d5iezb_: 5iez B: [328551] Other proteins in same PDB: d5ieza2, d5iezd2 automated match to d2kbwa_ complexed with 6al |
PDB Entry: 5iez (more details), 2.6 Å
SCOPe Domain Sequences for d5iezb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iezb_ f.1.4.1 (B:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Human (Homo sapiens) [TaxId: 9606]} delyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgm lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla esitdvlvrtkrdwlvkqrgwdgfveffhved
Timeline for d5iezb_: