Lineage for d5l69n_ (5l69 N:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2202517Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2202526Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2282291Domain d5l69n_: 5l69 N: [325592]
    Other proteins in same PDB: d5l69b_, d5l69c_, d5l69d_, d5l69e_, d5l69f_, d5l69g_, d5l69h_, d5l69k_, d5l69l_, d5l69m_, d5l69p_, d5l69q_, d5l69r_, d5l69s_, d5l69t_, d5l69u_, d5l69v_, d5l69y_, d5l69z_
    automated match to d1g0un_
    complexed with 79p, cl, mes, mg

Details for d5l69n_

PDB Entry: 5l69 (more details), 2.7 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 16
PDB Compounds: (N:) Proteasome subunit beta type-1

SCOPe Domain Sequences for d5l69n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l69n_ d.153.1.4 (N:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d5l69n_:

Click to download the PDB-style file with coordinates for d5l69n_.
(The format of our PDB-style files is described here.)

Timeline for d5l69n_:

  • d5l69n_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12