![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 protein domains) |
![]() | Protein automated matches [190144] (11 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (156 PDB entries) |
![]() | Domain d5l69h_: 5l69 H: [325554] Other proteins in same PDB: d5l69a_, d5l69c_, d5l69d_, d5l69e_, d5l69g_, d5l69i_, d5l69j_, d5l69k_, d5l69l_, d5l69n_, d5l69o_, d5l69q_, d5l69r_, d5l69s_, d5l69u_, d5l69w_, d5l69x_, d5l69y_, d5l69z_ automated match to d4r17h_ complexed with 79p, cl, mes, mg |
PDB Entry: 5l69 (more details), 2.7 Å
SCOPe Domain Sequences for d5l69h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l69h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d5l69h_: