Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5l69p_: 5l69 P: [325643] Other proteins in same PDB: d5l69a_, d5l69c1, d5l69c2, d5l69d_, d5l69e_, d5l69g_, d5l69i_, d5l69j_, d5l69k_, d5l69l_, d5l69n_, d5l69o_, d5l69q1, d5l69q2, d5l69r_, d5l69s_, d5l69u_, d5l69w_, d5l69x_, d5l69y_, d5l69z_ automated match to d1z7qc1 complexed with 79p, cl, mes, mg |
PDB Entry: 5l69 (more details), 2.7 Å
SCOPe Domain Sequences for d5l69p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l69p_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d5l69p_:
View in 3D Domains from other chains: (mouse over for more information) d5l69a_, d5l69b_, d5l69c1, d5l69c2, d5l69d_, d5l69e_, d5l69f_, d5l69g_, d5l69h_, d5l69i_, d5l69j_, d5l69k_, d5l69l_, d5l69m_, d5l69n_, d5l69o_, d5l69q1, d5l69q2, d5l69r_, d5l69s_, d5l69t_, d5l69u_, d5l69v_, d5l69w_, d5l69x_, d5l69y_, d5l69z_ |