PDB entry 1fnt

View 1fnt on RCSB PDB site
Description: crystal structure of the 20s proteasome from yeast in complex with the proteasome activator pa26 from trypanosome brucei at 3.2 angstroms resolution
Deposited on 2000-08-23, released 2001-04-11
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.255
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome component C7-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Proteasome component Y7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Proteasome component Y13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Proteasome component PRE6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Proteasome component PUP2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Proteasome component PRE5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Proteasome component C1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Proteasome component PRE3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Proteasome component PUP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Proteasome component PUP3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Proteasome component C11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Proteasome component PRE2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30656 (0-211)
      • engineered (32)
  • Chain 'M':
    Compound: Proteasome component C5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Proteasome component PRE4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Proteasome component C7-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Proteasome component Y7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Proteasome component Y13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Proteasome component PRE6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Proteasome component PUP2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Proteasome component PRE5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Proteasome component C1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Proteasome component PRE3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Proteasome component PUP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Proteasome component PUP3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Proteasome component C11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Proteasome component PRE2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30656 (0-211)
      • engineered (32)
  • Chain 'a':
    Compound: Proteasome component C5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Proteasome component PRE4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'd':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'e':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'f':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'g':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'h':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'i':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'j':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'k':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'l':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'm':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'n':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'o':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Chain 'p':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (Start-230)
      • see remark 999 (48)
      • see remark 999 (225)
  • Heterogens: MG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1fntA (A:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records):
    >1fntA (A:)
    hitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvsyifc
    isrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytqraym
    rplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkkskidhi
    neeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiaeqd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1fntB (B:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

    Sequence, based on observed residues (ATOM records):
    >1fntB (B:)
    rysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamsetlsk
    vslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqeatq
    sggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwndel
    eledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrkltsqei
    ndrleal
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1fntC (C:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgit
    

    Sequence, based on observed residues (ATOM records):
    >1fntC (C:)
    rydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtste
    klyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytq
    hgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddm
    kvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgi
    t
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1fntD (D:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records):
    >1fntD (D:)
    dralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritpskv
    skidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytqsg
    gvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrkep
    patveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqeq
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1fntE (E:)
    mfltrseydrgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratsplle
    sdsiekiveidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdla
    lrfgegasgeerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaq
    aellnewhssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaeli
    kelkekeaaespeeadvems
    

    Sequence, based on observed residues (ATOM records):
    >1fntE (E:)
    eydrgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiek
    iveidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgeg
    asgeerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellne
    whssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkek
    eaae
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1fntF (F:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records):
    >1fntF (F:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1fntG (G:)
    tsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvp
    qknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvq
    ahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvd
    hhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaid
    faqkeingdddededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records):
    >1fntG (G:)
    dlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknvkiq
    vvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtlyns
    vrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpegls
    areavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqkein
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >1fntH (H:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1fntI (I:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records):
    >1fntI (I:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1fntJ (J:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records):
    >1fntJ (J:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >1fntK (K:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >1fntL (L:)
    tttlafrfqggiivavdsratagnwvasqtvkrvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records:
    >1fntM (M:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records:
    >1fntN (N:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >1fntO (O:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records):
    >1fntO (O:)
    hitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvsyifc
    isrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytqraym
    rplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkkskidhi
    neeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiaeqd
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >1fntP (P:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

    Sequence, based on observed residues (ATOM records):
    >1fntP (P:)
    rysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamsetlsk
    vslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqeatq
    sggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwndel
    eledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrkltsqei
    ndrleal
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >1fntQ (Q:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgit
    

    Sequence, based on observed residues (ATOM records):
    >1fntQ (Q:)
    rydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtste
    klyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytq
    hgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddm
    kvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgi
    t
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >1fntR (R:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records):
    >1fntR (R:)
    dralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritpskv
    skidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytqsg
    gvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrkep
    patveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqeq
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >1fntS (S:)
    mfltrseydrgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratsplle
    sdsiekiveidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdla
    lrfgegasgeerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaq
    aellnewhssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaeli
    kelkekeaaespeeadvems
    

    Sequence, based on observed residues (ATOM records):
    >1fntS (S:)
    eydrgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiek
    iveidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgeg
    asgeerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellne
    whssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkek
    eaae
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >1fntT (T:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records):
    >1fntT (T:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >1fntU (U:)
    tsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvp
    qknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvq
    ahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvd
    hhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaid
    faqkeingdddededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records):
    >1fntU (U:)
    dlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknvkiq
    vvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtlyns
    vrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpegls
    areavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqkein
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records:
    >1fntV (V:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >1fntW (W:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records):
    >1fntW (W:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >1fntX (X:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records):
    >1fntX (X:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records:
    >1fntY (Y:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records:
    >1fntZ (Z:)
    tttlafrfqggiivavdsratagnwvasqtvkrvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'a':
    Sequence; same for both SEQRES and ATOM records:
    >1fnta (a:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'b':
    Sequence; same for both SEQRES and ATOM records:
    >1fntb (b:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >1fntc (c:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fntc (c:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >1fntd (d:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fntd (d:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >1fnte (e:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fnte (e:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'f':
    Sequence, based on SEQRES records:
    >1fntf (f:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fntf (f:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >1fntg (g:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fntg (g:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'h':
    Sequence, based on SEQRES records:
    >1fnth (h:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fnth (h:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'i':
    Sequence, based on SEQRES records:
    >1fnti (i:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fnti (i:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'j':
    Sequence, based on SEQRES records:
    >1fntj (j:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fntj (j:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'k':
    Sequence, based on SEQRES records:
    >1fntk (k:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fntk (k:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'l':
    Sequence, based on SEQRES records:
    >1fntl (l:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fntl (l:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'm':
    Sequence, based on SEQRES records:
    >1fntm (m:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fntm (m:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'n':
    Sequence, based on SEQRES records:
    >1fntn (n:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fntn (n:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'o':
    Sequence, based on SEQRES records:
    >1fnto (o:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fnto (o:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs
    

  • Chain 'p':
    Sequence, based on SEQRES records:
    >1fntp (p:)
    mppkraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqa
    ekspeqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiidel
    eiktlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspsll
    lelrqidadfmlkvelatthlstmvravinayllnwkkliqprtgtdhmvs
    

    Sequence, based on observed residues (ATOM records):
    >1fntp (p:)
    aaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaekspe
    qllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleiktl
    gsgeksgsggaptpigmyalrespslllelrqidadfmlkvelatthlstmvravinayl
    lnwkkliqprtgtdhmvs