![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
![]() | Protein automated matches [190509] (15 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (94 PDB entries) |
![]() | Domain d5l69r_: 5l69 R: [325971] Other proteins in same PDB: d5l69a_, d5l69b_, d5l69f_, d5l69g_, d5l69h_, d5l69i_, d5l69j_, d5l69k_, d5l69l_, d5l69m_, d5l69n_, d5l69o_, d5l69p_, d5l69t_, d5l69u_, d5l69v_, d5l69w_, d5l69x_, d5l69y_, d5l69z_ automated match to d1iruf_ complexed with 79p, cl, mes, mg |
PDB Entry: 5l69 (more details), 2.7 Å
SCOPe Domain Sequences for d5l69r_:
Sequence, based on SEQRES records: (download)
>d5l69r_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea ae
>d5l69r_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae
Timeline for d5l69r_: