Lineage for d5l69d_ (5l69 D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2205325Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2205326Protein automated matches [190509] (14 species)
    not a true protein
  7. 2205369Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2282520Domain d5l69d_: 5l69 D: [325821]
    Other proteins in same PDB: d5l69a_, d5l69b_, d5l69f_, d5l69g_, d5l69h_, d5l69i_, d5l69j_, d5l69k_, d5l69l_, d5l69m_, d5l69n_, d5l69o_, d5l69p_, d5l69t_, d5l69u_, d5l69v_, d5l69w_, d5l69x_, d5l69y_, d5l69z_
    automated match to d1iruf_
    complexed with 79p, cl, mes, mg

Details for d5l69d_

PDB Entry: 5l69 (more details), 2.7 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 16
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5l69d_:

Sequence, based on SEQRES records: (download)

>d5l69d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5l69d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5l69d_:

Click to download the PDB-style file with coordinates for d5l69d_.
(The format of our PDB-style files is described here.)

Timeline for d5l69d_:

  • d5l69d_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-12