Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
Species Cow (Bos taurus) [TaxId:9913] [81638] (19 PDB entries) Uniprot P00157 |
Domain d5klvc1: 5klv C:3-260 [323996] Other proteins in same PDB: d5klva1, d5klva2, d5klvb1, d5klvb2, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvh_, d5klvj_, d5klvk_ automated match to d1ntmc2 complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4 |
PDB Entry: 5klv (more details), 2.65 Å
SCOPe Domain Sequences for d5klvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5klvc1 f.21.1.2 (C:3-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} nirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttta fssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilllt vmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafh filpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmll vlfapdllgdpdnytpan
Timeline for d5klvc1: