![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() automatically mapped to Pfam PF02939 |
![]() | Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
![]() | Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81503] (21 PDB entries) Uniprot P13271 #SP ! Uniprot P13271 |
![]() | Domain d5klvg_: 5klv G: [323988] Other proteins in same PDB: d5klva1, d5klva2, d5klvb1, d5klvb2, d5klvc1, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvh_, d5klvj_, d5klvk_ automated match to d1be3g_ complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4 |
PDB Entry: 5klv (more details), 2.65 Å
SCOPe Domain Sequences for d5klvg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5klvg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt wgtqefekskrknpa
Timeline for d5klvg_: