SCOPe 2.07: Domain d5klvc1: 5klv C:3-260

Lineage for d5klvc1 (5klv C:3-260)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
   also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits

7. Species Cow (Bos taurus) [TaxId:9913] [81638] (19 PDB entries)
   Uniprot P00157

8. Domain d5klvc1: 5klv C:3-260 [323996]
   Other proteins in same PDB: d5klva1, d5klva2, d5klvb1, d5klvb2, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvh_, d5klvj_, d5klvk_
   automated match to d1ntmc2
   complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4

Details for d5klvc1

PDB Entry: 5klv, 2.65 Å

PDB Description: structure of bos taurus cytochrome bc1 with fenamidone inhibited

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d5klvc1:

Sequence; same for both SEQRES and ATOM records:

>d5klvc1 f.21.1.2 (C:3-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
nirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttta
fssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilllt
vmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafh
filpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmll
vlfapdllgdpdnytpan

Timeline for d5klvc1:

• d5klvc1 first appeared in SCOPe 2.06
  
• d5klvc1 appears in the current release, SCOPe 2.08