Lineage for d5klvd1 (5klv D:1-195)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304198Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 2304199Protein Cytochrome bc1 domain [46677] (3 species)
  7. 2304215Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries)
    Uniprot P00125
  8. 2304230Domain d5klvd1: 5klv D:1-195 [323984]
    Other proteins in same PDB: d5klva1, d5klva2, d5klvb1, d5klvb2, d5klvc1, d5klvc2, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvh_, d5klvj_, d5klvk_
    automated match to d1ntmd1
    complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4

Details for d5klvd1

PDB Entry: 5klv (more details), 2.65 Å

PDB Description: structure of bos taurus cytochrome bc1 with fenamidone inhibited
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d5klvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5klvd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d5klvd1:

Click to download the PDB-style file with coordinates for d5klvd1.
(The format of our PDB-style files is described here.)

Timeline for d5klvd1: