Lineage for d5klvh_ (5klv H:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580157Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2580158Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 2580159Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 2580160Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 2580173Species Cow (Bos taurus) [TaxId:9913] [81526] (13 PDB entries)
    Uniprot P00126
  8. 2580183Domain d5klvh_: 5klv H: [323991]
    Other proteins in same PDB: d5klva1, d5klva2, d5klvb1, d5klvb2, d5klvc1, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvj_, d5klvk_
    automated match to d1ntmh_
    complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4

Details for d5klvh_

PDB Entry: 5klv (more details), 2.65 Å

PDB Description: structure of bos taurus cytochrome bc1 with fenamidone inhibited
PDB Compounds: (H:) cytochrome b-c1 complex subunit 6, mitochondrial

SCOPe Domain Sequences for d5klvh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5klvh_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
klfnslk

SCOPe Domain Coordinates for d5klvh_:

Click to download the PDB-style file with coordinates for d5klvh_.
(The format of our PDB-style files is described here.)

Timeline for d5klvh_: