Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) location - intermembrane side of the bc1 complex automatically mapped to Pfam PF02320 |
Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81526] (14 PDB entries) Uniprot P00126 |
Domain d5klvh_: 5klv H: [323991] Other proteins in same PDB: d5klva1, d5klva2, d5klvb1, d5klvb2, d5klvc1, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvj_, d5klvk_ automated match to d1ntmh_ complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4 |
PDB Entry: 5klv (more details), 2.65 Å
SCOPe Domain Sequences for d5klvh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5klvh_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah klfnslk
Timeline for d5klvh_: