Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) automatically mapped to Pfam PF05365 |
Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries) Uniprot P00130 |
Domain d5klvj_: 5klv J: [324121] Other proteins in same PDB: d5klva1, d5klva2, d5klvb1, d5klvb2, d5klvc1, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvh_, d5klvk_ automated match to d2a06w_ complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4 |
PDB Entry: 5klv (more details), 2.65 Å
SCOPe Domain Sequences for d5klvj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5klvj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye n
Timeline for d5klvj_: