Lineage for d5klvj_ (5klv J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026015Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 3026016Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 3026017Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 3026028Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries)
    Uniprot P00130
  8. 3026043Domain d5klvj_: 5klv J: [324121]
    Other proteins in same PDB: d5klva1, d5klva2, d5klvb1, d5klvb2, d5klvc1, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvh_, d5klvk_
    automated match to d2a06w_
    complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4

Details for d5klvj_

PDB Entry: 5klv (more details), 2.65 Å

PDB Description: structure of bos taurus cytochrome bc1 with fenamidone inhibited
PDB Compounds: (J:) Cytochrome b-c1 complex subunit 9

SCOPe Domain Sequences for d5klvj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5klvj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
n

SCOPe Domain Coordinates for d5klvj_:

Click to download the PDB-style file with coordinates for d5klvj_.
(The format of our PDB-style files is described here.)

Timeline for d5klvj_: