Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) automatically mapped to Pfam PF08997 |
Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins) |
Protein automated matches [190648] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187726] (5 PDB entries) |
Domain d5klvk_: 5klv K: [323998] Other proteins in same PDB: d5klva1, d5klva2, d5klvb1, d5klvb2, d5klvc1, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvh_, d5klvj_ automated match to d1sqqk1 complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4 |
PDB Entry: 5klv (more details), 2.65 Å
SCOPe Domain Sequences for d5klvk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5klvk_ f.23.15.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingk
Timeline for d5klvk_: