Lineage for d5klvk_ (5klv K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026085Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
    automatically mapped to Pfam PF08997
  5. 3026086Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins)
  6. 3026102Protein automated matches [190648] (1 species)
    not a true protein
  7. 3026103Species Cow (Bos taurus) [TaxId:9913] [187726] (5 PDB entries)
  8. 3026106Domain d5klvk_: 5klv K: [323998]
    Other proteins in same PDB: d5klva1, d5klva2, d5klvb1, d5klvb2, d5klvc1, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvh_, d5klvj_
    automated match to d1sqqk1
    complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4

Details for d5klvk_

PDB Entry: 5klv (more details), 2.65 Å

PDB Description: structure of bos taurus cytochrome bc1 with fenamidone inhibited
PDB Compounds: (K:) cytochrome b-c1 complex subunit 10

SCOPe Domain Sequences for d5klvk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5klvk_ f.23.15.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingk

SCOPe Domain Coordinates for d5klvk_:

Click to download the PDB-style file with coordinates for d5klvk_.
(The format of our PDB-style files is described here.)

Timeline for d5klvk_: