Lineage for d2vhop1 (2vho P:1-82)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200238Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1200239Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1200240Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1200241Protein Ribosomal protein S16 [54567] (3 species)
  7. 1200244Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 1200265Domain d2vhop1: 2vho P:1-82 [153138]
    Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
    automatically matched to 2AVY P:1-82
    protein/RNA complex; complexed with mg

Details for d2vhop1

PDB Entry: 2vho (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2vhop1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhop1 d.27.1.1 (P:1-82) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnkaa

SCOPe Domain Coordinates for d2vhop1:

Click to download the PDB-style file with coordinates for d2vhop1.
(The format of our PDB-style files is described here.)

Timeline for d2vhop1: