Lineage for d2vhoe2 (2vho E:9-77)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1202665Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1202666Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 1202741Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 1202742Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 1202745Species Escherichia coli [TaxId:562] [160202] (24 PDB entries)
    Uniprot P0A7W1 9-77
  8. 1202766Domain d2vhoe2: 2vho E:9-77 [153127]
    Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
    automatically matched to 2AVY E:9-77
    protein/RNA complex; complexed with mg

Details for d2vhoe2

PDB Entry: 2vho (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2vhoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhoe2 d.50.1.2 (E:9-77) Ribosomal S5 protein, N-terminal domain {Escherichia coli [TaxId: 562]}
elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
nminvalnn

SCOPe Domain Coordinates for d2vhoe2:

Click to download the PDB-style file with coordinates for d2vhoe2.
(The format of our PDB-style files is described here.)

Timeline for d2vhoe2: