Lineage for d2vhor1 (2vho R:19-73)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1080920Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1080921Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1080922Protein Ribosomal protein S18 [46913] (2 species)
  7. 1080923Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
    Uniprot P0A7T7 19-73
  8. 1080944Domain d2vhor1: 2vho R:19-73 [153140]
    Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhos1, d2vhot1, d2vhou1
    automatically matched to 2AVY R:19-73
    protein/RNA complex; complexed with mg

Details for d2vhor1

PDB Entry: 2vho (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2vhor1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhor1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

SCOPe Domain Coordinates for d2vhor1:

Click to download the PDB-style file with coordinates for d2vhor1.
(The format of our PDB-style files is described here.)

Timeline for d2vhor1: