SCOPe 2.02: Domain d2vhok1: 2vho K:12-128

Lineage for d2vhok1 (2vho K:12-128)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (2 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein S11 [53141] (2 species)

7. Species Escherichia coli [TaxId:562] [159644] (24 PDB entries)
   Uniprot P0A7R9 12-128

8. Domain d2vhok1: 2vho K:12-128 [153133]
   Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
   automatically matched to 2AVY K:12-128
   protein/RNA complex; complexed with mg

Details for d2vhok1

PDB Entry: 2vho, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)

PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d2vhok1:

Sequence; same for both SEQRES and ATOM records:

>d2vhok1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]}
rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv

Timeline for d2vhok1:

• d2vhok1 first appeared in SCOP 1.75
  
• d2vhok1 appears in SCOPe 2.01
  
• d2vhok1 appears in SCOPe 2.03
  
• d2vhok1 appears in the current release, SCOPe 2.08