Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
Species Escherichia coli [TaxId:562] [160439] (26 PDB entries) Uniprot P0A7V8 1-205 |
Domain d2vhod1: 2vho D:1-205 [153125] Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1 automatically matched to 2AVY D:1-205 protein/RNA complex; complexed with mg |
PDB Entry: 2vho (more details), 3.74 Å
SCOPe Domain Sequences for d2vhod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhod1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt fkrkpersdlsadinehlivelysk
Timeline for d2vhod1: