Lineage for d2vhoe1 (2vho E:78-158)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194044Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1194045Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1194046Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1194087Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 1194090Species Escherichia coli [TaxId:562] [159906] (24 PDB entries)
    Uniprot P0A7W1 78-158
  8. 1194111Domain d2vhoe1: 2vho E:78-158 [153126]
    Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
    automatically matched to 2AVY E:78-158
    protein/RNA complex; complexed with mg

Details for d2vhoe1

PDB Entry: 2vho (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2vhoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhoe1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]}
gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr
atidglenmnspemvaakrgk

SCOPe Domain Coordinates for d2vhoe1:

Click to download the PDB-style file with coordinates for d2vhoe1.
(The format of our PDB-style files is described here.)

Timeline for d2vhoe1: