SCOPe 2.02: Domain d2vhoc1: 2vho C:1-105

Lineage for d2vhoc1 (2vho C:1-105)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)

7. Species Escherichia coli [TaxId:562] [160236] (24 PDB entries)
   Uniprot P0A7V3 1-105

8. Domain d2vhoc1: 2vho C:1-105 [153123]
   Other proteins in same PDB: d2vhob1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
   automatically matched to 2AVY C:1-105
   protein/RNA complex; complexed with mg

Details for d2vhoc1

PDB Entry: 2vho, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2vhoc1:

Sequence; same for both SEQRES and ATOM records:

>d2vhoc1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev

Timeline for d2vhoc1:

• d2vhoc1 first appeared in SCOP 1.75
  
• d2vhoc1 appears in SCOPe 2.01
  
• d2vhoc1 appears in SCOPe 2.03
  
• d2vhoc1 appears in the current release, SCOPe 2.08