Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
Protein automated matches [191237] (8 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370429] (7 PDB entries) |
Domain d6ijje_: 6ijj E: [416118] Other proteins in same PDB: d6ijj1_, d6ijj3_, d6ijj4_, d6ijj7_, d6ijj8_, d6ijja_, d6ijjb_, d6ijjc_, d6ijjd_, d6ijjf_, d6ijjj_, d6ijjl_ automated match to d7dz7e_ complexed with bcr, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, xat |
PDB Entry: 6ijj (more details), 2.89 Å
SCOPe Domain Sequences for d6ijje_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ijje_ b.34.4.0 (E:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} kevgpkrgslvkilrpesywfnqvgkvvsvdqsgvrypvvvrfenqnyagvttnnyalde vvaa
Timeline for d6ijje_: