Lineage for d6ijje_ (6ijj E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783857Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2783858Protein automated matches [191237] (8 species)
    not a true protein
  7. 2783899Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370429] (7 PDB entries)
  8. 2783904Domain d6ijje_: 6ijj E: [416118]
    Other proteins in same PDB: d6ijj1_, d6ijj3_, d6ijj4_, d6ijj7_, d6ijj8_, d6ijja_, d6ijjb_, d6ijjc_, d6ijjd_, d6ijjf_, d6ijjj_, d6ijjl_
    automated match to d7dz7e_
    complexed with bcr, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, xat

Details for d6ijje_

PDB Entry: 6ijj (more details), 2.89 Å

PDB Description: photosystem i of chlamydomonas reinhardtii
PDB Compounds: (E:) PsaE

SCOPe Domain Sequences for d6ijje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ijje_ b.34.4.0 (E:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
kevgpkrgslvkilrpesywfnqvgkvvsvdqsgvrypvvvrfenqnyagvttnnyalde
vvaa

SCOPe Domain Coordinates for d6ijje_:

Click to download the PDB-style file with coordinates for d6ijje_.
(The format of our PDB-style files is described here.)

Timeline for d6ijje_:

  • d6ijje_ is new in SCOPe 2.08-stable