Lineage for d6ijjc_ (6ijj C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949080Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2949145Protein automated matches [236563] (10 species)
    not a true protein
  7. 2949156Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370446] (5 PDB entries)
  8. 2949159Domain d6ijjc_: 6ijj C: [416116]
    Other proteins in same PDB: d6ijj1_, d6ijj3_, d6ijj4_, d6ijj7_, d6ijj8_, d6ijja_, d6ijjb_, d6ijjd_, d6ijje_, d6ijjf_, d6ijjj_, d6ijjl_
    automated match to d5oy0c_
    complexed with bcr, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, xat

Details for d6ijjc_

PDB Entry: 6ijj (more details), 2.89 Å

PDB Description: photosystem i of chlamydomonas reinhardtii
PDB Compounds: (C:) PsaC

SCOPe Domain Sequences for d6ijjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ijjc_ d.58.1.2 (C:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ahivkiydtcigctqcvracpldvlemvpwdgckasqmasaprtedcvgckrcetacptd
flsvrvylgsestrsmglsy

SCOPe Domain Coordinates for d6ijjc_:

Click to download the PDB-style file with coordinates for d6ijjc_.
(The format of our PDB-style files is described here.)

Timeline for d6ijjc_:

  • d6ijjc_ is new in SCOPe 2.08-stable