Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein automated matches [236563] (10 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370446] (5 PDB entries) |
Domain d6ijjc_: 6ijj C: [416116] Other proteins in same PDB: d6ijj1_, d6ijj3_, d6ijj4_, d6ijj7_, d6ijj8_, d6ijja_, d6ijjb_, d6ijjd_, d6ijje_, d6ijjf_, d6ijjj_, d6ijjl_ automated match to d5oy0c_ complexed with bcr, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, xat |
PDB Entry: 6ijj (more details), 2.89 Å
SCOPe Domain Sequences for d6ijjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ijjc_ d.58.1.2 (C:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} ahivkiydtcigctqcvracpldvlemvpwdgckasqmasaprtedcvgckrcetacptd flsvrvylgsestrsmglsy
Timeline for d6ijjc_: