Lineage for d6ijjd_ (6ijj D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005547Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 3005548Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 3005549Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 3005562Protein automated matches [236562] (8 species)
    not a true protein
  7. 3005570Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370481] (7 PDB entries)
  8. 3005575Domain d6ijjd_: 6ijj D: [416117]
    Other proteins in same PDB: d6ijj1_, d6ijj3_, d6ijj4_, d6ijj7_, d6ijj8_, d6ijja_, d6ijjb_, d6ijjc_, d6ijje_, d6ijjf_, d6ijjj_, d6ijjl_
    automated match to d6jo6d_
    complexed with bcr, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, xat

Details for d6ijjd_

PDB Entry: 6ijj (more details), 2.89 Å

PDB Description: photosystem i of chlamydomonas reinhardtii
PDB Compounds: (D:) PsaD

SCOPe Domain Sequences for d6ijjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ijjd_ d.187.1.1 (D:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
awtvptlnpdtpspifggstggllrkaqteefyvitweakkeqifemptggaaimrqgpn
llkfgkkeqclalttqlrnkfkltpcfyrvfpdgkvqylhpadgvypekvnagrvganqn
mrrigqnvnpikvkfsgrmmspae

SCOPe Domain Coordinates for d6ijjd_:

Click to download the PDB-style file with coordinates for d6ijjd_.
(The format of our PDB-style files is described here.)

Timeline for d6ijjd_:

  • d6ijjd_ is new in SCOPe 2.08-stable