Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily) beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail |
Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) automatically mapped to Pfam PF02531 |
Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins) |
Protein automated matches [236562] (8 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370481] (7 PDB entries) |
Domain d6ijjd_: 6ijj D: [416117] Other proteins in same PDB: d6ijj1_, d6ijj3_, d6ijj4_, d6ijj7_, d6ijj8_, d6ijja_, d6ijjb_, d6ijjc_, d6ijje_, d6ijjf_, d6ijjj_, d6ijjl_ automated match to d6jo6d_ complexed with bcr, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, xat |
PDB Entry: 6ijj (more details), 2.89 Å
SCOPe Domain Sequences for d6ijjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ijjd_ d.187.1.1 (D:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} awtvptlnpdtpspifggstggllrkaqteefyvitweakkeqifemptggaaimrqgpn llkfgkkeqclalttqlrnkfkltpcfyrvfpdgkvqylhpadgvypekvnagrvganqn mrrigqnvnpikvkfsgrmmspae
Timeline for d6ijjd_: