Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) automatically mapped to Pfam PF02605 |
Family f.31.1.0: automated matches [375525] (1 protein) not a true family |
Protein automated matches [375526] (6 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [420020] (5 PDB entries) |
Domain d6ijjl_: 6ijj L: [416121] Other proteins in same PDB: d6ijj1_, d6ijj3_, d6ijj4_, d6ijj7_, d6ijj8_, d6ijja_, d6ijjb_, d6ijjc_, d6ijjd_, d6ijje_, d6ijjf_, d6ijjj_ automated match to d6k61l_ complexed with bcr, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, xat |
PDB Entry: 6ijj (more details), 2.89 Å
SCOPe Domain Sequences for d6ijjl_:
Sequence, based on SEQRES records: (download)
>d6ijjl_ f.31.1.0 (L:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} vatylsnlpayrtgvapvlrgveiglahgfllagpfiklgplrnvpetaeiagslsaagl vlilalclsiygsaqfqstpsigvktlsgrsvardplfsadgwsefaagflvggeagvaw ayvct
>d6ijjl_ f.31.1.0 (L:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} vatylsnlpayrtgvapvlrgveiglahgfllagpfiklgplrnvpetaeiagslsaagl vlilalclsiygsaqflfsadgwsefaagflvggeagvawayvct
Timeline for d6ijjl_: