Lineage for d6ijjl_ (6ijj L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027932Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 3027933Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 3027955Family f.31.1.0: automated matches [375525] (1 protein)
    not a true family
  6. 3027956Protein automated matches [375526] (6 species)
    not a true protein
  7. 3027965Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [420020] (5 PDB entries)
  8. 3027968Domain d6ijjl_: 6ijj L: [416121]
    Other proteins in same PDB: d6ijj1_, d6ijj3_, d6ijj4_, d6ijj7_, d6ijj8_, d6ijja_, d6ijjb_, d6ijjc_, d6ijjd_, d6ijje_, d6ijjf_, d6ijjj_
    automated match to d6k61l_
    complexed with bcr, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, xat

Details for d6ijjl_

PDB Entry: 6ijj (more details), 2.89 Å

PDB Description: photosystem i of chlamydomonas reinhardtii
PDB Compounds: (L:) PsaL

SCOPe Domain Sequences for d6ijjl_:

Sequence, based on SEQRES records: (download)

>d6ijjl_ f.31.1.0 (L:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
vatylsnlpayrtgvapvlrgveiglahgfllagpfiklgplrnvpetaeiagslsaagl
vlilalclsiygsaqfqstpsigvktlsgrsvardplfsadgwsefaagflvggeagvaw
ayvct

Sequence, based on observed residues (ATOM records): (download)

>d6ijjl_ f.31.1.0 (L:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
vatylsnlpayrtgvapvlrgveiglahgfllagpfiklgplrnvpetaeiagslsaagl
vlilalclsiygsaqflfsadgwsefaagflvggeagvawayvct

SCOPe Domain Coordinates for d6ijjl_:

Click to download the PDB-style file with coordinates for d6ijjl_.
(The format of our PDB-style files is described here.)

Timeline for d6ijjl_:

  • d6ijjl_ is new in SCOPe 2.08-stable