Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
Protein automated matches [276200] (4 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370435] (9 PDB entries) |
Domain d6ijj7_: 6ijj 7: [416112] Other proteins in same PDB: d6ijja_, d6ijjb_, d6ijjc_, d6ijjd_, d6ijje_, d6ijjf_, d6ijjj_, d6ijjl_ automated match to d7dz77_ complexed with bcr, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, xat |
PDB Entry: 6ijj (more details), 2.89 Å
SCOPe Domain Sequences for d6ijj7_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ijj7_ f.43.1.0 (7:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} vrpvwfpgnpppahldgslagdygfdplflgqepqtlkwyvqaelvhgrfamlgaagiil tsigakvglgfpewydagkvvveknnidfptlmviqfylmgwaetkrwydfknpgsqadg sflgfteefkglengypggrffdpmglsrgdaakyqeykqkevkngrlamiaclgfaaqy aatgkgpldnladhladpnhvnfatngvsipia
Timeline for d6ijj7_: