Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) automatically mapped to Pfam PF02605 |
Family f.31.1.0: automated matches [375525] (1 protein) not a true family |
Protein automated matches [375526] (6 species) not a true protein |
Species Nostoc sp. [TaxId:103690] [375527] (1 PDB entry) |
Domain d6k61l_: 6k61 L: [375528] Other proteins in same PDB: d6k61a_, d6k61b_, d6k61c_, d6k61d_, d6k61e_, d6k61f_, d6k61j_, d6k61m_ automated match to d1jb0l_ complexed with bcr, cl0, cla, lhg, lmg, pqn, sf4, sqd |
PDB Entry: 6k61 (more details), 2.37 Å
SCOPe Domain Sequences for d6k61l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k61l_ f.31.1.0 (L:) automated matches {Nostoc sp. [TaxId: 103690]} nrevvfpagrdpqwgnletpvnasplvkwfinnlpayrpgltpfrrglevgmahgyflfg pfaklgplrdaananlagllgaiglvvlftlalslyansnpptalasvtvpnppdafqsk egwnnfasafliggiggavvayfltsnlaliqglv
Timeline for d6k61l_: