Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) |
Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species) |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [103430] (1 PDB entry) |
Domain d1q90r_: 1q90 R: [96248] Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90a4, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_ complexed with bcr, cla, fes, hec, lfa, lmg, sqd, tds |
PDB Entry: 1q90 (more details), 3.1 Å
SCOPe Domain Sequences for d1q90r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q90r_ f.23.12.1 (R:) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} ssevpdmnkrnimnlilaggaglpittlalgygaffvpp
Timeline for d1q90r_: