Lineage for d1q90g_ (1q90 G:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026327Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family) (S)
  5. 3026328Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins)
  6. 3026329Protein PetG subunit of the cytochrome b6f complex [103448] (2 species)
  7. 3026330Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [103450] (1 PDB entry)
  8. 3026331Domain d1q90g_: 1q90 G: [96244]
    Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90a4, d1q90b_, d1q90c_, d1q90d_, d1q90l_, d1q90m_, d1q90n_, d1q90r_
    complexed with bcr, cla, fes, hec, lfa, lmg, sqd, tds

Details for d1q90g_

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
PDB Compounds: (G:) Cytochrome b6f complex subunit petG

SCOPe Domain Sequences for d1q90g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90g_ f.23.26.1 (G:) PetG subunit of the cytochrome b6f complex {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mvepllcgivlglvpvtiaglfvtaylqyl

SCOPe Domain Coordinates for d1q90g_:

Click to download the PDB-style file with coordinates for d1q90g_.
(The format of our PDB-style files is described here.)

Timeline for d1q90g_: