![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family) ![]() |
![]() | Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins) |
![]() | Protein PetG subunit of the cytochrome b6f complex [103448] (2 species) |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [103450] (1 PDB entry) |
![]() | Domain d1q90g_: 1q90 G: [96244] Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90a4, d1q90b_, d1q90c_, d1q90d_, d1q90l_, d1q90m_, d1q90n_, d1q90r_ complexed with bcr, cla, fes, hec, lfa, lmg, sqd, tds |
PDB Entry: 1q90 (more details), 3.1 Å
SCOPe Domain Sequences for d1q90g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q90g_ f.23.26.1 (G:) PetG subunit of the cytochrome b6f complex {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} mvepllcgivlglvpvtiaglfvtaylqyl
Timeline for d1q90g_: