PDB entry 1q90

View 1q90 on RCSB PDB site
Description: Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from Chlamydomonas reinhardtii
Class: photosynthesis
Keywords: membrane protein complex, photosynthesis, electron transfer, oxydoreductase, chlorophyll, beta-carotene, stigmatellin, sulfoquinovosyldiacylglycerol, monogalactosyldiacylglycerol
Deposited on 2003-08-22, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.222
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apocytochrome f
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: PETA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23577 (0-285)
      • expression tag (286-291)
    Domains in SCOPe 2.07: d1q90a1, d1q90a2, d1q90a3, d1q90a4
  • Chain 'B':
    Compound: Cytochrome b6
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: PETB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q90b_
  • Chain 'C':
    Compound: Cytochrome b6-f complex iron-sulfur subunit
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: PETC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q90c_
  • Chain 'D':
    Compound: Cytochrome b6-f complex subunit 4
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: PETD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q90d_
  • Chain 'G':
    Compound: Cytochrome b6f complex subunit petG
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: PETG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q90g_
  • Chain 'L':
    Compound: Cytochrome b6f complex subunit petL
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: PETL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q90l_
  • Chain 'M':
    Compound: Cytochrome b6f complex subunit PETM
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: PETM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q90m_
  • Chain 'N':
    Compound: Cytochrome b6f complex subunit PETN
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: PETN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q90n_
  • Chain 'R':
    Compound: Cytochrome b6-f complex iron-sulfur subunit
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: PETC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q90r_
  • Heterogens: HEM, FES, CLA, BCR, TDS, SQD, LFA, LMG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q90A (A:)
    ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
    langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
    kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnntiynasaagkiv
    aitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpltnnpnvggfgqa
    eteivlqnpariqgllvffsfvlltqvllvlkkkqfekvqlaemnfhhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q90B (B:)
    mskvydwfeerleiqaiadditskyvpphvnifyciggitftcflvqvatgfamtfyyrp
    tvaeafasvqyimtdvnfgwlirsihrwsasmmvlmmvlhvfrvyltggfkrpreltwvt
    gvimavctvsfgvtgyslpwdqvgywavkivtgvpdaipgvggfivellrggvgvgqatl
    trfyslhtfvlplltavfmlmhflmirkqgisgpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q90B (B:)
    vydwfeerleiqaiadditskyvpphvnifyciggitftcflvqvatgfamtfyyrptva
    eafasvqyimtdvnfgwlirsihrwsasmmvlmmvlhvfrvyltggfkrpreltwvtgvi
    mavctvsfgvtgyslpwdqvgywavkivtgvpdaipgvggfivellrggvgvgqatltrf
    yslhtfvlplltavfmlmhflmirkqgisgpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q90C (C:)
    qaakdalgndikagewlkthlagdrslsqglkgdptylivtadstiekyglnavcthlgc
    vvpwvaaenkfkcpchgsqynaegkvvrgpaplslalahcdvaesglvtfstwtetdfrt
    glepwwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q90C (C:)
    qaakdalgndikagewlkthlagdrslsqglkgdptylivtadstiekyglnavcthlgc
    vvpwvaaenkfkcpchgsqynaegkvvrgpaplslalahcdvaeglvtfstwtetdfrtg
    lepwwa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q90D (D:)
    msvtkkpdlsdpvlkaklakgmghntygepawpndllymfpvvilgtfacviglsvldpa
    amgepanpfatpleilpewyfypvfqilrvvpnkllgvllmaavpaglitvpfiesinkf
    qnpyrrpiatilfllgtlvavwlgigstfpidisltlgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q90D (D:)
    tkkpdlsdpvlkaklakgmghntygepawpndllymfpvvilgtfacviglsvldpaamg
    epanpfatpleilpewyfypvfqilrvvpnkllgvllmaavpaglitvpfiesinkfqnp
    yrrpiatilfllgtlvavwlgigstfpidisltlgl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1q90G (G:)
    mvepllcgivlglvpvtiaglfvtaylqylrgdlaty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q90G (G:)
    mvepllcgivlglvpvtiaglfvtaylqyl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q90L (L:)
    mltitsyvglligalvftlgiylgllkvvkli
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1q90M (M:)
    geaefiagtaltmvgmtlvglaigfvllrveslveegki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q90M (M:)
    eaefiagtaltmvgmtlvglaigfvllrveslve
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q90N (N:)
    gepaivqigwaatcvmfsfslslvvwgrsgl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1q90R (R:)
    aassevpdmnkrnimnlilaggaglpittlalgygaffvppssgggggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q90R (R:)
    ssevpdmnkrnimnlilaggaglpittlalgygaffvpp