![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
![]() | Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein) |
![]() | Protein Cytochrome f, small domain [51257] (5 species) |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [51259] (6 PDB entries) |
![]() | Domain d1q90a2: 1q90 A:169-232 [96239] Other proteins in same PDB: d1q90a1, d1q90a3, d1q90a4, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_ complexed with bcr, cla, fes, hec, lfa, lmg, sqd, tds |
PDB Entry: 1q90 (more details), 3.1 Å
SCOPe Domain Sequences for d1q90a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q90a2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl tnnp
Timeline for d1q90a2: