SCOPe 2.08: Domain d1q90b_: 1q90 B:

Lineage for d1q90b_ (1q90 B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species)

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [103500] (1 PDB entry)

8. Domain d1q90b_: 1q90 B: [96241]
   Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90a4, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_
   complexed with bcr, cla, fes, hec, lfa, lmg, sqd, tds

Details for d1q90b_

PDB Entry: 1q90, 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii

PDB Compounds: (B:) Cytochrome b6

SCOPe Domain Sequences for d1q90b_:

Sequence; same for both SEQRES and ATOM records:

>d1q90b_ f.21.1.2 (B:) Cytochrome b6 subunit of the cytochrome b6f complex {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
vydwfeerleiqaiadditskyvpphvnifyciggitftcflvqvatgfamtfyyrptva
eafasvqyimtdvnfgwlirsihrwsasmmvlmmvlhvfrvyltggfkrpreltwvtgvi
mavctvsfgvtgyslpwdqvgywavkivtgvpdaipgvggfivellrggvgvgqatltrf
yslhtfvlplltavfmlmhflmirkqgisgpl

Timeline for d1q90b_:

• d1q90b_ first appeared in SCOP 1.67
  
• d1q90b_ appears in SCOPe 2.07