Lineage for d1q90a3 (1q90 A:248-286)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026281Superfamily f.23.23: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103431] (1 family) (S)
  5. 3026282Family f.23.23.1: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103432] (1 protein)
  6. 3026283Protein Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103433] (2 species)
  7. 3026284Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [103435] (1 PDB entry)
  8. 3026285Domain d1q90a3: 1q90 A:248-286 [96240]
    Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a4, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_
    complexed with bcr, cla, fes, hec, lfa, lmg, sqd, tds

Details for d1q90a3

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
PDB Compounds: (A:) Apocytochrome f

SCOPe Domain Sequences for d1q90a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90a3 f.23.23.1 (A:248-286) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
npariqgllvffsfvlltqvllvlkkkqfekvqlaemnf

SCOPe Domain Coordinates for d1q90a3:

Click to download the PDB-style file with coordinates for d1q90a3.
(The format of our PDB-style files is described here.)

Timeline for d1q90a3: