SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1q90a1 (1q90 A:1-168,A:233-247)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2034670Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 2034671Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 2034672Protein Cytochrome f, large domain [49443] (5 species)
    this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
  7. 2034673Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [49445] (6 PDB entries)
  8. 2034688Domain d1q90a1: 1q90 A:1-168,A:233-247 [96238]
    Other proteins in same PDB: d1q90a2, d1q90a3, d1q90a4, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_
    complexed with bcr, cla, fes, hem, lfa, lmg, sqd, tds

Details for d1q90a1

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from Chlamydomonas reinhardtii
PDB Compounds: (A:) Apocytochrome f

SCOPe Domain Sequences for d1q90a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90a1 b.2.6.1 (A:1-168,A:233-247) Cytochrome f, large domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnnXnvggfgqaete
ivlq

SCOPe Domain Coordinates for d1q90a1:

Click to download the PDB-style file with coordinates for d1q90a1.
(The format of our PDB-style files is described here.)

Timeline for d1q90a1: