Lineage for d1q90a1 (1q90 A:1-168,A:233-247)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2034670Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 2034671Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 2034672Protein Cytochrome f, large domain [49443] (5 species)
    this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
  7. 2034673Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [49445] (6 PDB entries)
  8. 2034688Domain d1q90a1: 1q90 A:1-168,A:233-247 [96238]
    Other proteins in same PDB: d1q90a2, d1q90a3, d1q90a4, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_
    complexed with bcr, cla, fes, hem, lfa, lmg, sqd, tds

Details for d1q90a1

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from Chlamydomonas reinhardtii
PDB Compounds: (A:) Apocytochrome f

SCOPe Domain Sequences for d1q90a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90a1 b.2.6.1 (A:1-168,A:233-247) Cytochrome f, large domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnnXnvggfgqaete
ivlq

SCOPe Domain Coordinates for d1q90a1:

Click to download the PDB-style file with coordinates for d1q90a1.
(The format of our PDB-style files is described here.)

Timeline for d1q90a1: