Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) |
Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (1 protein) |
Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (1 species) |
Species Synechococcus elongatus [TaxId:32046] [81537] (1 PDB entry) |
Domain d1jb0i_: 1jb0 I: [62826] Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_ complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn |
PDB Entry: 1jb0 (more details), 2.5 Å
SCOP Domain Sequences for d1jb0i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb0i_ f.23.17.1 (I:) Subunit VIII of photosystem I reaction centre, PsaI {Synechococcus elongatus} mmgsyaasflpwifipvvcwlmptvvmgllflyiegea
Timeline for d1jb0i_: