Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (10 families) |
Family f.2.1.12: Photosystem I [64531] (1 protein) |
Protein Photosystem I [64532] (1 species) |
Species Synechococcus elongatus [TaxId:32046] [64533] (1 PDB entry) |
Domain d1jb0i_: 1jb0 I: [62826] Other proteins in same PDB: d1jb0c_, d1jb0d_, d1jb0e_ |
PDB Entry: 1jb0 (more details), 2.5 Å
SCOP Domain Sequences for d1jb0i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb0i_ f.2.1.12 (I:) Photosystem I {Synechococcus elongatus} mmgsyaasflpwifipvvcwlmptvvmgllflyiegea
Timeline for d1jb0i_: