Lineage for d1jb0i_ (1jb0 I:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 88028Family f.2.1.12: Photosystem I [64531] (1 protein)
  6. 88029Protein Photosystem I [64532] (1 species)
  7. 88030Species Synechococcus elongatus [TaxId:32046] [64533] (1 PDB entry)
  8. 88034Domain d1jb0i_: 1jb0 I: [62826]
    Other proteins in same PDB: d1jb0c_, d1jb0d_, d1jb0e_

Details for d1jb0i_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria

SCOP Domain Sequences for d1jb0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb0i_ f.2.1.12 (I:) Photosystem I {Synechococcus elongatus}
mmgsyaasflpwifipvvcwlmptvvmgllflyiegea

SCOP Domain Coordinates for d1jb0i_:

Click to download the PDB-style file with coordinates for d1jb0i_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0i_: