![]() | Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
![]() | Fold f.30: Photosystem I reaction center subunit X, PsaK [81564] (1 superfamily) core: hairpin of two transmembrane helices |
![]() | Superfamily f.30.1: Photosystem I reaction center subunit X, PsaK [81563] (1 family) ![]() |
![]() | Family f.30.1.1: Photosystem I reaction center subunit X, PsaK [81562] (1 protein) |
![]() | Protein Photosystem I reaction center subunit X, PsaK [81561] (1 species) |
![]() | Species Synechococcus elongatus [TaxId:32046] [81560] (1 PDB entry) |
![]() | Domain d1jb0k_: 1jb0 K: [62828] Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0l_, d1jb0m_, d1jb0x_ complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn |
PDB Entry: 1jb0 (more details), 2.5 Å
SCOP Domain Sequences for d1jb0k_:
Sequence, based on SEQRES records: (download)
>d1jb0k_ f.30.1.1 (K:) Photosystem I reaction center subunit X, PsaK {Synechococcus elongatus} ilcnlfaialgryaiqsrgkgpglpialpalfegfglpellattsfghllaagvvsgl
>d1jb0k_ f.30.1.1 (K:) Photosystem I reaction center subunit X, PsaK {Synechococcus elongatus} ilcnlfaialgryiqsrgkgpglglpellattsfghllaagvvsgl
Timeline for d1jb0k_: