Lineage for d1jb0k_ (1jb0 K:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426839Fold f.30: Photosystem I reaction center subunit X, PsaK [81564] (1 superfamily)
    core: hairpin of two transmembrane helices
  4. 426840Superfamily f.30.1: Photosystem I reaction center subunit X, PsaK [81563] (1 family) (S)
  5. 426841Family f.30.1.1: Photosystem I reaction center subunit X, PsaK [81562] (1 protein)
  6. 426842Protein Photosystem I reaction center subunit X, PsaK [81561] (1 species)
  7. 426843Species Synechococcus elongatus [TaxId:32046] [81560] (1 PDB entry)
  8. 426844Domain d1jb0k_: 1jb0 K: [62828]
    Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0l_, d1jb0m_, d1jb0x_
    complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn

Details for d1jb0k_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria

SCOP Domain Sequences for d1jb0k_:

Sequence, based on SEQRES records: (download)

>d1jb0k_ f.30.1.1 (K:) Photosystem I reaction center subunit X, PsaK {Synechococcus elongatus}
ilcnlfaialgryaiqsrgkgpglpialpalfegfglpellattsfghllaagvvsgl

Sequence, based on observed residues (ATOM records): (download)

>d1jb0k_ f.30.1.1 (K:) Photosystem I reaction center subunit X, PsaK {Synechococcus elongatus}
ilcnlfaialgryiqsrgkgpglglpellattsfghllaagvvsgl

SCOP Domain Coordinates for d1jb0k_:

Click to download the PDB-style file with coordinates for d1jb0k_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0k_: