Class b: All beta proteins [48724] (141 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) |
Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (1 protein) |
Protein Photosystem I accessory protein E (PsaE) [50095] (4 species) |
Species Synechococcus elongatus [TaxId:32046] [63752] (1 PDB entry) |
Domain d1jb0e_: 1jb0 E: [62824] Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_ complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn |
PDB Entry: 1jb0 (more details), 2.5 Å
SCOP Domain Sequences for d1jb0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb0e_ b.34.4.2 (E:) Photosystem I accessory protein E (PsaE) {Synechococcus elongatus} vqrgskvkilrpesywynevgtvasvdqtpgvkypvivrfdkvnytgysgsasgvntnnf alhevqeva
Timeline for d1jb0e_: