Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.19: Subunit XII of photosystem I reaction centre, PsaM [81548] (1 family) |
Family f.23.19.1: Subunit XII of photosystem I reaction centre, PsaM [81547] (1 protein) |
Protein Subunit XII of photosystem I reaction centre, PsaM [81546] (1 species) |
Species Synechococcus elongatus [TaxId:32046] [81545] (1 PDB entry) |
Domain d1jb0m_: 1jb0 M: [62830] Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0x_ complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn |
PDB Entry: 1jb0 (more details), 2.5 Å
SCOP Domain Sequences for d1jb0m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb0m_ f.23.19.1 (M:) Subunit XII of photosystem I reaction centre, PsaM {Synechococcus elongatus} maltdtqvyvalviallpavlafrlstelyk
Timeline for d1jb0m_: