Lineage for d1jb0m_ (1jb0 M:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426178Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 426513Superfamily f.23.19: Subunit XII of photosystem I reaction centre, PsaM [81548] (1 family) (S)
  5. 426514Family f.23.19.1: Subunit XII of photosystem I reaction centre, PsaM [81547] (1 protein)
  6. 426515Protein Subunit XII of photosystem I reaction centre, PsaM [81546] (1 species)
  7. 426516Species Synechococcus elongatus [TaxId:32046] [81545] (1 PDB entry)
  8. 426517Domain d1jb0m_: 1jb0 M: [62830]
    Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0x_
    complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn

Details for d1jb0m_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria

SCOP Domain Sequences for d1jb0m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb0m_ f.23.19.1 (M:) Subunit XII of photosystem I reaction centre, PsaM {Synechococcus elongatus}
maltdtqvyvalviallpavlafrlstelyk

SCOP Domain Coordinates for d1jb0m_:

Click to download the PDB-style file with coordinates for d1jb0m_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0m_: