Lineage for d1jb0f_ (1jb0 F:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426178Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 426498Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (1 family) (S)
  5. 426499Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (1 protein)
  6. 426500Protein Subunit III of photosystem I reaction centre, PsaF [81534] (1 species)
  7. 426501Species Synechococcus elongatus [TaxId:32046] [81533] (1 PDB entry)
  8. 426502Domain d1jb0f_: 1jb0 F: [62825]
    Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_
    complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn

Details for d1jb0f_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria

SCOP Domain Sequences for d1jb0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb0f_ f.23.16.1 (F:) Subunit III of photosystem I reaction centre, PsaF {Synechococcus elongatus}
dvaglvpckdspafqkraaaavnttadpasgqkrferysqalcgedglphlvvdgrlsra
gdflipsvlflyiagwigwvgrayliavrnsgeanekeiiidvplaikcmltgfawplaa
lkelasgeltakdneitvspr

SCOP Domain Coordinates for d1jb0f_:

Click to download the PDB-style file with coordinates for d1jb0f_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0f_: