Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (1 family) |
Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (1 protein) |
Protein Subunit IX of photosystem I reaction centre, PsaJ [81542] (1 species) |
Species Synechococcus elongatus [TaxId:32046] [81541] (1 PDB entry) |
Domain d1jb0j_: 1jb0 J: [62827] Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_ complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn |
PDB Entry: 1jb0 (more details), 2.5 Å
SCOP Domain Sequences for d1jb0j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb0j_ f.23.18.1 (J:) Subunit IX of photosystem I reaction centre, PsaJ {Synechococcus elongatus} mkhfltylstapvlaaiwmtitagiliefnrfypdllfhpl
Timeline for d1jb0j_: