Lineage for d1jb0i_ (1jb0 I:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340729Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 340988Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) (S)
  5. 340989Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (1 protein)
  6. 340990Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (1 species)
  7. 340991Species Synechococcus elongatus [TaxId:32046] [81537] (1 PDB entry)
  8. 340992Domain d1jb0i_: 1jb0 I: [62826]
    Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_
    complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn

Details for d1jb0i_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria

SCOP Domain Sequences for d1jb0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb0i_ f.23.17.1 (I:) Subunit VIII of photosystem I reaction centre, PsaI {Synechococcus elongatus}
mmgsyaasflpwifipvvcwlmptvvmgllflyiegea

SCOP Domain Coordinates for d1jb0i_:

Click to download the PDB-style file with coordinates for d1jb0i_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0i_: