Lineage for d1jb0i_ (1jb0 I:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026161Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) (S)
  5. 3026162Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins)
  6. 3026163Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (2 species)
  7. 3026164Species Synechococcus elongatus [TaxId:32046] [81537] (1 PDB entry)
  8. 3026165Domain d1jb0i_: 1jb0 I: [62826]
    Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x1, d1jb0x2
    complexed with bcr, ca, cla, lhg, lmg, pqn, sf4

Details for d1jb0i_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
PDB Compounds: (I:) photosystem 1 reaction centre subunit viii

SCOPe Domain Sequences for d1jb0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb0i_ f.23.17.1 (I:) Subunit VIII of photosystem I reaction centre, PsaI {Synechococcus elongatus [TaxId: 32046]}
mmgsyaasflpwifipvvcwlmptvvmgllflyiegea

SCOPe Domain Coordinates for d1jb0i_:

Click to download the PDB-style file with coordinates for d1jb0i_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0i_: