SCOPe 2.08: Domain d6yacf_: 6yac F:

Lineage for d6yacf_ (6yac F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families)
   automatically mapped to Pfam PF02507

5. Family f.23.16.0: automated matches [276195] (1 protein)
   not a true family

6. Protein automated matches [276199] (5 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276202] (9 PDB entries)

8. Domain d6yacf_: 6yac F: [393617]
   Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yaca_, d6yacb_, d6yacc_, d6yacd_, d6yace1, d6yace2, d6yacj_, d6yacl_, d6yacn_
   automated match to d5l8rf_
   complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yacf_

PDB Entry: 6yac, 2.5 Å

PDB Description: plant psi-ferredoxin supercomplex

PDB Compounds: (F:) PsaF

SCOPe Domain Sequences for d6yacf_:

Sequence; same for both SEQRES and ATOM records:

>d6yacf_ f.23.16.0 (F:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
diagltpckdskqfakrekqsikklesslklyapdsapalainatiektkrrfdnygkqg
llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairddkkptqkeii
idvplatglvfrgfswpiaayrellngelvakdv

Timeline for d6yacf_:

• d6yacf_ first appeared in SCOPe 2.07