Lineage for d6yacf_ (6yac F:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026109Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 3026136Family f.23.16.0: automated matches [276195] (1 protein)
    not a true family
  6. 3026137Protein automated matches [276199] (5 species)
    not a true protein
  7. 3026151Species Pea (Pisum sativum) [TaxId:3888] [276202] (9 PDB entries)
  8. 3026153Domain d6yacf_: 6yac F: [393617]
    Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yaca_, d6yacb_, d6yacc_, d6yacd_, d6yace1, d6yace2, d6yacj_, d6yacl_, d6yacn_
    automated match to d5l8rf_
    complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yacf_

PDB Entry: 6yac (more details), 2.5 Å

PDB Description: plant psi-ferredoxin supercomplex
PDB Compounds: (F:) PsaF

SCOPe Domain Sequences for d6yacf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yacf_ f.23.16.0 (F:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
diagltpckdskqfakrekqsikklesslklyapdsapalainatiektkrrfdnygkqg
llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairddkkptqkeii
idvplatglvfrgfswpiaayrellngelvakdv

SCOPe Domain Coordinates for d6yacf_:

Click to download the PDB-style file with coordinates for d6yacf_.
(The format of our PDB-style files is described here.)

Timeline for d6yacf_: