![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) ![]() automatically mapped to Pfam PF02507 |
![]() | Family f.23.16.0: automated matches [276195] (1 protein) not a true family |
![]() | Protein automated matches [276199] (5 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276202] (9 PDB entries) |
![]() | Domain d6yacf_: 6yac F: [393617] Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yaca_, d6yacb_, d6yacc_, d6yacd_, d6yace1, d6yace2, d6yacj_, d6yacl_, d6yacn_ automated match to d5l8rf_ complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yac (more details), 2.5 Å
SCOPe Domain Sequences for d6yacf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yacf_ f.23.16.0 (F:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} diagltpckdskqfakrekqsikklesslklyapdsapalainatiektkrrfdnygkqg llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairddkkptqkeii idvplatglvfrgfswpiaayrellngelvakdv
Timeline for d6yacf_: