SCOPe 2.08: Domain d6yacj_: 6yac J:

Lineage for d6yacj_ (6yac J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families)
   automatically mapped to Pfam PF01701

5. Family f.23.18.0: automated matches [276196] (1 protein)
   not a true family

6. Protein automated matches [276198] (5 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276201] (9 PDB entries)

8. Domain d6yacj_: 6yac J: [393637]
   Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yaca_, d6yacb_, d6yacc_, d6yacd_, d6yace1, d6yace2, d6yacf_, d6yacl_, d6yacn_
   automated match to d5l8rj_
   complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yacj_

PDB Entry: 6yac, 2.5 Å

PDB Description: plant psi-ferredoxin supercomplex

PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d6yacj_:

Sequence; same for both SEQRES and ATOM records:

>d6yacj_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mrdlktylsvapvastlwfaalagllieinrffpdaltfpff

Timeline for d6yacj_:

• d6yacj_ first appeared in SCOPe 2.07