![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
![]() | Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) ![]() automatically mapped to Pfam PF02605 |
![]() | Family f.31.1.0: automated matches [375525] (1 protein) not a true family |
![]() | Protein automated matches [375526] (6 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries) |
![]() | Domain d6yacl_: 6yac L: [412222] Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yaca_, d6yacb_, d6yacc_, d6yacd_, d6yace1, d6yace2, d6yacf_, d6yacj_, d6yacn_ automated match to d6k61l_ complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yac (more details), 2.5 Å
SCOPe Domain Sequences for d6yacl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yacl_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} yqvvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgfllvgp fvkagplrnteiagqagslaagglvvilsicltiygissfnegdpstapsltltgrkkqp dqlqtadgwakftggfffggisgviwaffllyvldlp
Timeline for d6yacl_: