Lineage for d6yacl_ (6yac L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027932Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 3027933Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 3027955Family f.31.1.0: automated matches [375525] (1 protein)
    not a true family
  6. 3027956Protein automated matches [375526] (6 species)
    not a true protein
  7. 3027971Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries)
  8. 3027973Domain d6yacl_: 6yac L: [412222]
    Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yaca_, d6yacb_, d6yacc_, d6yacd_, d6yace1, d6yace2, d6yacf_, d6yacj_, d6yacn_
    automated match to d6k61l_
    complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yacl_

PDB Entry: 6yac (more details), 2.5 Å

PDB Description: plant psi-ferredoxin supercomplex
PDB Compounds: (L:) PsaL

SCOPe Domain Sequences for d6yacl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yacl_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
yqvvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgfllvgp
fvkagplrnteiagqagslaagglvvilsicltiygissfnegdpstapsltltgrkkqp
dqlqtadgwakftggfffggisgviwaffllyvldlp

SCOPe Domain Coordinates for d6yacl_:

Click to download the PDB-style file with coordinates for d6yacl_.
(The format of our PDB-style files is described here.)

Timeline for d6yacl_:

  • d6yacl_ is new in SCOPe 2.08-stable