SCOPe 2.08: Domain d6yacc_: 6yac C:

Lineage for d6yacc_ (6yac C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
   has C-terminal extension to the common fold

6. Protein automated matches [236563] (10 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276244] (9 PDB entries)

8. Domain d6yacc_: 6yac C: [393645]
   Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yaca_, d6yacb_, d6yacd_, d6yace1, d6yace2, d6yacf_, d6yacj_, d6yacl_, d6yacn_
   automated match to d5l8rc_
   complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yacc_

PDB Entry: 6yac, 2.5 Å

PDB Description: plant psi-ferredoxin supercomplex

PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d6yacc_:

Sequence; same for both SEQRES and ATOM records:

>d6yacc_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
flsvrvylwhettrsmglay

Timeline for d6yacc_:

• d6yacc_ first appeared in SCOPe 2.07