SCOPe 2.08: Domain d6yace1: 6yac E:66-129

Lineage for d6yace1 (6yac E:66-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.0: automated matches [191659] (1 protein)
   not a true family

6. Protein automated matches [191237] (8 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [311431] (8 PDB entries)

8. Domain d6yace1: 6yac E:66-129 [393612]
   Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yaca_, d6yacb_, d6yacc_, d6yacd_, d6yace2, d6yacf_, d6yacj_, d6yacl_, d6yacn_
   automated match to d4y28e_
   complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yace1

PDB Entry: 6yac, 2.5 Å

PDB Description: plant psi-ferredoxin supercomplex

PDB Compounds: (E:) PsaE

SCOPe Domain Sequences for d6yace1:

Sequence; same for both SEQRES and ATOM records:

>d6yace1 b.34.4.0 (E:66-129) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
igpkrgakvkilrqesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyaldev
eevk

Timeline for d6yace1:

• d6yace1 first appeared in SCOPe 2.07