| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
| Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
| Protein automated matches [191237] (8 species) not a true protein |
| Species Pea (Pisum sativum) [TaxId:3888] [311431] (8 PDB entries) |
| Domain d6yace1: 6yac E:66-129 [393612] Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yaca_, d6yacb_, d6yacc_, d6yacd_, d6yace2, d6yacf_, d6yacj_, d6yacl_, d6yacn_ automated match to d4y28e_ complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yac (more details), 2.5 Å
SCOPe Domain Sequences for d6yace1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yace1 b.34.4.0 (E:66-129) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
igpkrgakvkilrqesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyaldev
eevk
Timeline for d6yace1: